Dave Grusin - ... One Of A Kind (Vinyl, LP, Album)


Download Dave Grusin - ... One Of A Kind (Vinyl, LP, Album)
1977
Label: Polydor - MPF 1145 • Format: Vinyl LP, Album, Promo • Country: Japan • Genre: Jazz • Style: Fusion, Jazz-Funk


Sitemap

Paavo Berglund - Smetana Ma Vlast (CD, Album), Piedras Al Sol - Zenet - Todas Las Calles (CD, Album), I Love You Too - The Bluzblasters - Get Blasted! (Vinyl, LP, Album), Segment Two - Paul Weller - A Conversation With Paul Weller (CD), Sullys No. 6 - Lúnasa - Lúnasa (CD, Album), Can You Feel It (Tropical Mix) - Fish (6) - Can You Feel It (Vinyl), The Journey - Molly Hatchet - Locked And Loaded (CD, Album), Скажи Мені - Руслана* - Дикі Танці (CDr), Arvo Pärt - Arvo Pärt III - Orelimuusika / Koorimuusika (CDr), Suicide Intervention To Cherish The Grace - Primal Age - A Hell Romance (CD, Album), Manchi Solo Tu - vacca - Lultimo Tango (CD, Album), Journey Into Doom - Hypnos - The Revenge Ride (CD, Album), Cor Des Cammells - Pau Casals* - El Pessebre (Vinyl, LP), Aeropuerto - 2 Minutos - Un Mundo De Sensaciones (CD, Album), Empusa - Various - Olympus (File, MP3)

9 thoughts on “ Dave Grusin - ... One Of A Kind (Vinyl, LP, Album)

  1. Featuring Grover Washington, Ralph MacDonald, Ron Carter, Steve Gadd, Dave Valentin, Anthony Jackson, Don Elliott, Francisco Centeno. Recorded in This is a reissue on Dave Grusin and Larry Rosen's own GRP label. It was previously issued on Polydor in August with different cover and track sequence (Dave Grusin - One Of A Kind)/5(34).
  2. One Of A Kind on Discogs. Label: Polydor - MPF • Format: Vinyl LP, Album, Promo • Country: Japan • Genre: Jazz • Style: Fusion, Jazz-Funk Dave Grusin - 5/5(1).
  3. Dave Grusin. Jazz: Fusion, Funk. Vinyl, LP, 12" Full Album. A well played LP but also cared for. G+ Good Plus: May have a skip or two but rest of LP plays fine. Ex Excellent: A clean vinyl Seller Rating: % positive.
  4. Label: GRP - GRP • Series: Digital Master • Format: Vinyl LP, Album, Reissue • Country: Switzerland • Genre: Jazz • Style: Fusion, Jazz-Funk Dave Grusin - One Of A Kind (, Vinyl) | Discogs4/5(18).
  5. View credits, reviews, tracks and shop for the Vinyl release of One Of A Kind on Discogs. Label: Polydor - PD • Format: Vinyl LP, Album, Promo • Country: US • Genre: Jazz, Funk / Soul • Style: Smooth Jazz, Jazz-Funk/5(4).
  6. The sounds of the Hammond B3 organ is so beautiful, I almost wish my parents had conceived me one decade early -- that said, Dave Grusin shows us the breadth of the 70s musical magnificence. Having heard works of that period from The Crusaders, Bob James, et al. I have to say One of a Kind is very worthy of being that very prestige/5(12).
  7. Jazz LP Dave Grusin. Dave Grusin. One Of A Kind (GRP pressing) LP (Item ) GRP/Polydor, Out Of Stock LP, Vinyl record album. Related searches. LP, Vinyl record album. JJ Johnson/ Kai Winding/ Bennie Green Trombone By Three. Prestige, // trucuninmytimel.misadicvihercevacpyewatchcomdami.co: GRP/Polydor (Label).
  8. Released in and originally issued on LP in a single sleeve in by ABC/Blue Thumb in the U.S. & on ABC in the UK. Another fine album that maybe is slightly less essential than the proceeding 3. However it is still a worthwhile album to have and does include some /5(92).
  9. Oct 10,  · 50+ videos Play all Mix - Montage - Dave Grusin YouTube Lee Ritenour & Dave Grusin Live at Java Jazz Festival - Duration: JavaJazzFest 5,, views.

Leave a Comment