(I Just) Died In Your Arms - Various - Monsters Of Rock Volume 2 (CD)


Download (I Just) Died In Your Arms - Various - Monsters Of Rock Volume 2 (CD)
2000
Label: Razor & Tie - 7930189027-2 • Format: CD Compilation • Country: US • Genre: Rock • Style: Hard Rock, Arena Rock, Heavy Metal


Sitemap

God On My Side - World Party - Goodbye Jumbo (Vinyl, LP, Album), Gloria - Brahe Djäknar, Florakören, Gottfrid Gräsbeck, Akademiska Orkestern - Vivaldi - Gloria, Magn, No Regrets - Dramarama - Stuck In Wonderamaland (Vinyl, LP, Album), A Colloquial Dream (Scenes In The City) - Charles Mingus - The Alternate Moods Of Tijuana (Vinyl, LP, Beat Into Submission - Tryad - Public Domain (File, Album), The Way You Look Tonight - Teddy Wilson - Just A Mood (CD), Niemand - Krank (9) - Krank (Cassette), Disc Jockey Polka - Steve Adamczyk And His Hungry Six - Polkas With Steve Adamczyk And His Hungry Si, Mary Gauthier - Mercy Now / Season Of Mercy (CD, Album), Llora, Llora, Llora - The Copacabana Trio - Cuando Calienta El Sol (Vinyl, LP), Bad Blues - Fil Di Ferro - Rock Rock Rock (CD, Album), Auf Wiedersehn - Demis Roussos - Auf Wiedersehn / Walzer Für Zwei (Vinyl)

8 thoughts on “ (I Just) Died In Your Arms - Various - Monsters Of Rock Volume 2 (CD)

  1. Monsters of Rock Volume 2 is a compilation album that is a sequel to 's Monsters of Rock. It features 16 heavy metal, pop rock and arena rock hits from the s and s, many of which charted in the Top Ten or Top 40 of the Billboard Hot , with three going to Number trucuninmytimel.misadicvihercevacpyewatchcomdami.co: Heavy metal, Glam metal, Hard rock, Rock.
  2. Jun 02,  · Music video by Cutting Crew performing (I Just) Died In Your Arms. #CuttingCrew #DiedInYourArms #Vevo.
  3. "I Just) Died in Your Arms" is a song by the English pop rock band Cutting Crew. The song was released as the lead single from their debut studio album, Broadcast (). It was first released on 25 July in the United Kingdom, and then released to the United States on 1 January Genre: Pop rock.
  4. Cutting Crew discography and songs: Music profile for Cutting Crew, formed Genres: Pop Rock, AOR, Soft Rock. Albums include (I Just) Died in Your Arms / For the Longest Time, Grand Theft Auto: Vice City - Official Soundtrack Box Set, and Broadcast.
  5. Includes US Remix previously unavailable on compact disc. Part 25 of the Virgin CDT series beginning in , to promote back catalogue via a new format - 3"CD. The track 1 is the 12" full version of the Shelly Yakus mix. The short mix 4'25 is available on the USA cd album this short mix is an early fade version of this track 1.
  6. (I Just) Died in Your Arms “(I Just) Died in Your Arms” is a classic in the late 80’s pop rock genre, sung by English band Cutting Crew. The band was formed in London in , and are best known for their album: “Broadcast”, where “(I Just) Died in Your Arms” is the sixth song on the album.
  7. This is a cover of the 80's classic 'I Just Died In Your Arms Tonight' by Cutting Crew. Serena Spells: vocals Ash Cutler: piano Check out my YouTube page for.
  8. ["Official Lyrics Video"] I Just Died In Your Arms Tonight Cutting Crew Oh I, I just died in your arms tonight It must have been something you said I ju.

Leave a Comment