Vdova Polka - Dick Janak Orchestra - In The Olden Days (Tribute To Peter Janak) (Vinyl, LP)


Download Vdova Polka - Dick Janak Orchestra - In The Olden Days (Tribute To Peter Janak) (Vinyl, LP)
1981
Label: Micste Records - MSLP 9002 • Format: Vinyl LP • Country: US • Genre: Folk, World, & Country • Style: Polka


Sitemap

Guitar Rag - Merle Travis & Joe Maphis - Merle Travis & Joe Maphis (Vinyl, LP), Jump On It - Montrose (2) - Jump On It (CD, Album), Hymn: Jesu Redemptor - Schola Cantorum Of Amsterdam Students - Gregorian Chant (Vinyl, LP), Im Your Puppet - James & Bobby Purify - Im Your Puppet / So Many Reasons (Vinyl), Dont Tell It, Youve Got A Friend, Beat Into Submission - Tryad - Public Domain (File, Album), 4. Presto, Jukka Tolonen with Coste Apetrea - Touch Wood (Vinyl, LP, Album), Swamp Rat - Herbie Hancock - Secrets (Vinyl, LP, Album), What Do I Say? - Gumption (2) - Ultramaroon (CD), Ecoute La Merde / God Pussy - Ecoute La Merde / God Pussy (Cassette), Sleepwalk Sleeptalk - Naimy* - Sleepwalk Sleeptalk (Vinyl), Der König Von Hawaii, Schoolboy Blues - Paul Lenart - Acoustic Blues (CD)

9 thoughts on “ Vdova Polka - Dick Janak Orchestra - In The Olden Days (Tribute To Peter Janak) (Vinyl, LP)

  1. Double your traffic. DESCRIPTION This week we are listing a large amount of Polka and Waltze Records, including many from Ernst Mosch. They are all LP 33 Record Albums with the covers. In this particular listing is a group of 33 record albums. Many of which are Nebraska polka bands or recorded in Nebraska. Excellent condition overall on the group.
  2. The Krew Brothers ‎– A Lively Polka Session, vinyl LP, Steljo Records $ 6 Vtg Polka Music Records Lot 33 Rpm LP 12" Vinyl Album Pulaski Wisconsin Polish.
  3. Get the best deals on Polka LP Vinyl Records when you shop the largest online selection at trucuninmytimel.misadicvihercevacpyewatchcomdami.co Free shipping on many items A TRIBUTE TO OUR DAD - POLKA LP - estate sale. $ Genre: Folk. $ shipping. Style: Polka. or Best Offer. Dick Pillar Orchestra M- Vinyl LP Polkabration Hits Rare Polka Music Record. $ Genre: New.
  4. Dick Janak Orchestra - In the Olden Days Tribute to Peter Janak LP Vinyl Record EDDIE JANAK Remember Me A Tribute to LP PRIVATE POLKA WALTZES. C $ Was: Previous Price C $20 +C $ shipping; From France; EDDIE JANAK records 2 Picnic In the Woods & I Love to Dance polka vinyl s. C $; Buy It Now +C $ shipping; From.
  5. Welk, Lawrence & His Orchestra - The Best Of Lawrence Welk Polkas: Beer Barrel Polka, Clarinet Polka, Champagne Polka, Pennsylvania Polka, Liechtensteiner Polka, Chikcen Polka, High Life Polka (DELUXE 2 vinyl LP record set, gate-fold cover) - NM9/EX8 - LP.
  6. View credits, reviews, tracks and shop for the Vinyl release of Polka Music Hall of Fame Salute on Discogs.
  7. POLKA Vinyl Records and CDs. Polka Discography Price Guide Recently Listed Email Alerts Refine Search Results. Artist: Title: Label: Cat Num: Barcode: Genre: Country: Seller: Price: to polka .
  8. Jimmy Sturr & His Orchestra: Polka Party. out of 5 stars 5. DVD Starring: Jimmy Usually ships within 10 days. Starring: Greg Korin as "Stan Tadrowski" Directed by: John Mikulak and Joshua von Brown The Polka King (Original Motion Picture Soundtrack) by Jack Black | Jan 12, out of 5 stars Audio CD.

Leave a Comment